PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_30803-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 135aa    MW: 14712.2 Da    PI: 10.7114
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_30803-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.3e-1761108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++lvd ++  G g+W++ ++   ++R++k+c++rw +yl
  TRIUR3_30803-P1  61 KGPWTPEEDKQLVDFIQANGHGSWRLLPKLAELNRCGKSCRLRWTNYL 108
                      79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-2352111IPR009057Homeodomain-like
PROSITE profilePS5129423.50656112IPR017930Myb domain
SMARTSM007173.7E-1360110IPR001005SANT/Myb domain
PfamPF002491.2E-1561108IPR001005SANT/Myb domain
SuperFamilySSF466897.43E-2262135IPR009057Homeodomain-like
CDDcd001677.32E-1163108No hitNo description
Gene3DG3DSA:1.10.10.601.8E-7112135IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MAVEVVSSGV VALAAVLRSR LLLLVLVGLA SMTTSSSCSG ARGRSLPMGR APCCDRKGLK  60
KGPWTPEEDK QLVDFIQANG HGSWRLLPKL AELNRCGKSC RLRWTNYLRP DIKRGPFTAE  120
EQKSIVQLHG IVGNK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1659135580B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086211e-119AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624300.11e-58PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH47e-43MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLM7YZA34e-95M7YZA3_TRIUA; Myb-related protein Myb4
STRINGBGIOSGA008700-PA4e-58(Oryza sativa Indica Group)
STRINGLOC_Os02g42870.14e-58(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54093157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.12e-50myb domain protein 93